PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr038936.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family CO-like
Protein Properties Length: 448aa    MW: 50137.3 Da    PI: 4.8059
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr038936.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box25.92e-081659340
     zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                 +r C+ +  k++++fC  ++ +lC+ C  + H+       H++v
  Pbr038936.1 16 ARACDSCLVKRARWFCAADDAFLCQRCDASVHSAnqlasrHERV 59
                 678*****************************667888888876 PP

2CCT67.92.7e-23378421144
          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                  Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk++
  Pbr038936.1 378 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRT 421
                  9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.7E-101461IPR000315B-box-type zinc finger
PROSITE profilePS5011910.6081461IPR000315B-box-type zinc finger
PfamPF006435.0E-71659IPR000315B-box-type zinc finger
CDDcd000211.58E-91761No hitNo description
PROSITE profilePS5101716.083378420IPR010402CCT domain
PfamPF062036.1E-18378420IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 448 aa     Download sequence    Send to blast
MITDKKAANA MGGNTARACD SCLVKRARWF CAADDAFLCQ RCDASVHSAN QLASRHERVR  60
LQGSSFKANE PMQLTADQAT PAWHRGVKRK ARTPRHNKKP GFPIKEEQEK VGLHPPLPFV  120
PEIGCEEANL MEDEENEDLE QLLYRVPIYD PFAAKLCNIS STDQVENNTD AINLDDEEIE  180
IRNMGDNHEG VQDDLDKLGG FLPTEMELAE FAADVENLLG GGLDEDCSDI KGVLGLLDDG  240
KEVKVEEEVE GMEFNPSILD WNLDYDKSSA VPVQMGNEDN EEEEKLVLLT GAQSSDEMAF  300
MENKHMEMKR KKICLRLDYE TVITAWASQG SPWTNGTRPE LNPDDGWLDC MGMWPTEIPQ  360
PHGDTAGCVS GRGDDRGREA RVSRYREKRR TRLFSKKIRY EVRKLNAEKR PRMKGRFVKR  420
TTSSFGGVGS SSSNAPAAAF PYLMINK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1388404RRTRLFSKKIRYEVRKL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009360161.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 6-like
TrEMBLM5WFD00.0M5WFD0_PRUPE; Uncharacterized protein
STRINGPOPTR_0015s06480.11e-134(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14733392
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.16e-78B-box type zinc finger protein with CCT domain